Streptomyces chartreusis: CP983_38585 Help Entry CP983_38585       CDS       T07157                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism scha  Streptomyces chartreusis Pathway scha00998   Biosynthesis of various antibiotics scha01100   Metabolic pathways scha01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scha00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CP983_38585    00074 Mycolic acid biosynthesis     CP983_38585   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CP983_38585 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C RHH_10 DUF3874 Motif Other DBs NCBI-ProteinID:  QEV71979 LinkDB All DBs Position 8719752..8720015 Genome browser AA seq 87 aa AA seqDB search MTSTDIAAERENQIKELVADILELEPDEMTRTSRFKEDHEADSLLAIEILASLEKQFKIT IAQQELARMVNLEGVYEVVAEAAAARQ NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaccagcaccgacatcgccgcggagcgcgagaaccagatcaaggagctcgtggccgac atcctcgaactcgaacccgacgagatgacccgcaccagccgcttcaaggaggaccacgag gccgactccctgctcgcgatcgagatactcgcctccctggagaagcagttcaagatcacc atcgcccagcaggaactcgcccgcatggtgaacctggaaggcgtgtacgaggtggtggcc gaggccgccgcggcccggcagtag

DBGET integrated database retrieval system