Streptomyces chengbuensis: QRN89_14885 Help Entry QRN89_14885       CDS       T10474                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism sche  Streptomyces chengbuensis Pathway sche00253   Tetracycline biosynthesis sche01056   Biosynthesis of type II polyketide backbone sche01100   Metabolic pathways sche01110   Biosynthesis of secondary metabolites Module sche_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite Lipid biosynthesis proteins [BR:sche01004]  Polyketide synthase   Component type    QRN89_14885 Polyketide biosynthesis proteins [BR:sche01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      QRN89_14885     Nonaketide PKS      QRN89_14885     Decaketide PKS      QRN89_14885 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  WJY50980 LinkDB All DBs Position complement(3381138..3381395) Genome browser AA seq 85 aa AA seqDB search MREITLSKLQDIMRECAGEDDSGLPLEDGADRLFTDLGYDSLALLETQSRIEREYGVKFP DDTFEQVTTPRELVEHVNGLVLDAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcgagagatcacgctgtcgaagttgcaggacatcatgcgggagtgcgccggggaggac gactccggcctgccgctggaggacggcgccgaccgtctcttcaccgatctcggatacgac tcgctggcgctgctggagacgcagagccggatcgagcgggagtacggagtgaagttcccg gacgacaccttcgagcaggtcacgacgccacgggaactcgtggagcacgtcaacggactc gtgctcgacgcggcgtga

DBGET integrated database retrieval system