Streptomyces chromofuscus: IPT68_11445 Help Entry IPT68_11445       CDS       T07378                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism schf  Streptomyces chromofuscus Pathway schf00998   Biosynthesis of various antibiotics schf01100   Metabolic pathways schf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:schf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IPT68_11445    00074 Mycolic acid biosynthesis     IPT68_11445   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IPT68_11445 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QOV46456 UniProt:  A0A7M2TCK9 LinkDB All DBs Position 2541595..2541843 Genome browser AA seq 82 aa AA seqDB search MAATQEEIVAGLAEIVNEIAGIPTEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DDDVKNLKTVGDATEYILKHQS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcgtcgccggtctcgcggagatcgtgaacgagatcgcc gggatccccaccgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaggagcgcttcgacgtgaagatcccc gacgacgacgtcaagaacctcaagaccgtgggcgacgcgaccgagtacatcctcaagcac cagtcctga

DBGET integrated database retrieval system