Streptomyces chromofuscus: IPT68_15420 Help Entry IPT68_15420       CDS       T07378                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism schf  Streptomyces chromofuscus Pathway schf00253   Tetracycline biosynthesis schf01056   Biosynthesis of type II polyketide backbone schf01100   Metabolic pathways schf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:schf00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     IPT68_15420    00253 Tetracycline biosynthesis     IPT68_15420  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:schf01004]     IPT68_15420    01008 Polyketide biosynthesis proteins [BR:schf01008]     IPT68_15420 Lipid biosynthesis proteins [BR:schf01004]  Polyketide synthase   Component type    IPT68_15420 Polyketide biosynthesis proteins [BR:schf01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      IPT68_15420     Nonaketide PKS      IPT68_15420     Decaketide PKS      IPT68_15420 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QOV47139 UniProt:  A0A7M2TG65 LinkDB All DBs Position complement(3451643..3451915) Genome browser AA seq 90 aa AA seqDB search MPTQSFTLDDLKRILLESAGADENVDLDGDILDTDFEELSYESLAILETCGRIERDYGIS LDDGVVTEAKTPRALLEIVNAQLAESAQAA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgcccacccagtccttcaccctcgacgacctcaagcgcatcctcctggagtccgccggg gccgacgagaacgtcgacctggacggcgacatcctcgacaccgacttcgaggagctcagc tacgagtcgctggccatcctggagacctgcggccgcatcgagcgcgactacggcatctcc ctcgacgacggcgtggtcaccgaggcgaagacgccgcgggccctgctggagatcgtcaac gcccagctggcggagtcggcacaggccgcctga

DBGET integrated database retrieval system