Shewanella chilikensis: GII14_01590 Help Entry GII14_01590       CDS       T08813                                  Symbol zapB Name (GenBank) cell division protein ZapB   KO K09892   cell division protein ZapB Organism schk  Shewanella chilikensis Brite KEGG Orthology (KO) [BR:schk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:schk03036]     GII14_01590 (zapB) Chromosome and associated proteins [BR:schk03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     GII14_01590 (zapB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB YabA Nuf2_DHR10-like FPP Rootletin Muted XRCC4_CC CENP-Q Cep57_CLD_2 Tlp KIP1 DUF7656 Motif Other DBs NCBI-ProteinID:  QIJ02992 UniProt:  A0A6G7LMH7 LinkDB All DBs Position complement(325733..325936) Genome browser AA seq 67 aa AA seqDB search MSLELLSKLETKIQAALENIELLKMELEEEKQKNAHLIEQNQQLQQDLNSWNEKVTGLVG LLNDEVN NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgagcctagaattactgtccaaactggagaccaaaatccaggctgcgctcgaaaatatt gagcttctgaaaatggagctggaagaagaaaagcagaaaaatgctcatctgatagagcaa aaccaacaacttcagcaagatctcaactcgtggaacgagaaagttaccggccttgttggt ctgctcaacgacgaagtcaactga

DBGET integrated database retrieval system