Shewanella chilikensis: GII14_03090 Help Entry GII14_03090       CDS       T08813                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism schk  Shewanella chilikensis Brite KEGG Orthology (KO) [BR:schk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:schk03032]     GII14_03090    03036 Chromosome and associated proteins [BR:schk03036]     GII14_03090    03400 DNA repair and recombination proteins [BR:schk03400]     GII14_03090 DNA replication proteins [BR:schk03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     GII14_03090 Chromosome and associated proteins [BR:schk03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     GII14_03090 DNA repair and recombination proteins [BR:schk03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       GII14_03090 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG TFIIB HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  QIJ03263 UniProt:  A0A6G7LN88 LinkDB All DBs Position complement(667175..667447) Genome browser AA seq 90 aa AA seqDB search MNKTELIAKMAEHANLSKAEAARALKSFEVAVTDAMKEGSKISIVGFGSFETSTRAARTG RNPQTGKEIQIPAATIPKFKAGKALRDSVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaactgaactgatcgcaaaaatggcagaacatgcaaacctgtccaaagcagaa gctgcccgcgccctcaagtcgttcgaagtagcagtgactgatgccatgaaagaaggatct aaaatctccatcgtaggctttggttctttcgaaacctcaacccgcgcggcccgcactggc cgtaatccgcaaaccggtaaagagatccagatccctgccgctacgattcccaagttcaag gccggtaaggcactgcgtgacagcgtcaactaa

DBGET integrated database retrieval system