KEGG   Shewanella chilikensis: GII14_14125
Entry
GII14_14125       CDS       T08813                                 
Name
(GenBank) ABC transporter permease subunit
  KO
K19228  cationic peptide transport system permease protein
Organism
schk  Shewanella chilikensis
Pathway
schk01503  Cationic antimicrobial peptide (CAMP) resistance
schk02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:schk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    GII14_14125
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    GII14_14125
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:schk02000]
    GII14_14125
Transporters [BR:schk02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Cationic peptide transporter
    GII14_14125
SSDB
Motif
Pfam: BPD_transp_1 OppC_N
Other DBs
NCBI-ProteinID: QIJ05171
UniProt: A0A6G7LTT9
LinkDB
Position
3096102..3096992
AA seq 296 aa
MPQIKIYQEDDIPSPSLKLWRTFAANPFALAGLWGVLCLLILTMFGPMMAPYPADFQDPN
ALLLPPSWDDLGTVEHFLGTDDLGRDIFSRLLHGTSYTFGMALAIVATALLVGFIIGSFS
GMMRGLKSSILGHLLDALLSIPSLLMAILVVAVMGPGLMNVFWAVGIALTPQFVRAIHQA
VHEELQKEYVTAAKLDGANGLQIFWFVIMPNVWETVIIQTTLAISAAILDIAALGFLNLG
AQAPKSEWGAMVFQGLDNLLTAPWTVTIPGAAILLSVLAVNLVGDGLRSALAPIRN
NT seq 891 nt   +upstreamnt  +downstreamnt
atgcctcaaattaagatttatcaggaagacgatattccgtcccccagcctcaagctctgg
cgtacctttgccgccaacccttttgcgcttgccgggctttggggagtgctctgcctgctg
atcctgacaatgttcgggcccatgatggccccttacccggccgattttcaagatcccaac
gccctgttactgccaccatcctgggacgatctcggcacggttgagcactttctcggtaca
gacgatctcggcagggatatcttttcccgcctgctgcacggcaccagctacaccttcggc
atggcgctggcgattgttgccaccgcgctcctggtcggatttatcataggttcattctcg
gggatgatgcgcggcctcaagtccagtatccttgggcacctgctcgatgccttgctgtcg
attccatcactcttgatggccattttggtggtggcggtaatgggcccagggctgatgaac
gtattctgggccgtggggattgcgctcacccctcagtttgtgcgcgccatacatcaagcc
gtgcatgaagagttgcaaaaagagtatgtcaccgccgccaagttggatggtgccaatggt
ctgcagatattctggtttgtgattatgcccaatgtctgggagactgtgattattcaaacc
acgctggcaatatcagcggccattttggatatcgccgcgctgggttttctcaacctcggc
gcccaggcgcccaaatccgaatggggcgccatggtgttccaggggctggataacctgctg
accgctccctggactgtgaccattccgggagccgctatcctgctgagtgtattggccgtc
aacctggtcggcgatggactgagatcggcgcttgcgcccatcagaaactga

DBGET integrated database retrieval system