Shewanella chilikensis: GII14_20385 Help Entry GII14_20385       CDS       T08813                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism schk  Shewanella chilikensis Pathway schk01100   Metabolic pathways schk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:schk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GII14_20385    00074 Mycolic acid biosynthesis     GII14_20385   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GII14_20385 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QIJ06293 UniProt:  A0A6G7LWV4 LinkDB All DBs Position 4513846..4514094 Genome browser AA seq 82 aa AA seqDB search MQSREQILEMLSKILVDEFEVDAEAITPEASLYEELDLDSIDAVDLVIKLQQLTGKKIQP DEFKSVRTVNDVVNAIEGLVKD NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcaaagccgtgaacagatattggaaatgctgagcaagatcctggtcgatgagtttgaa gtggatgccgaggcgataacccctgaggcttccctctatgaagagctggatctggacagc atagatgcggtggatctggtgatcaaactgcaacagctgaccggcaaaaagatccagccc gatgaattcaagtcggtacggacagtcaacgacgtggttaacgccatcgagggactggtt aaagactga

DBGET integrated database retrieval system