KEGG   Schlesneria sp. DSM 10557: QJS52_08165
Entry
QJS52_08165       CDS       T10918                                 
Name
(GenBank) C-terminal binding protein
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
schl  Schlesneria sp. DSM 10557
Pathway
schl00260  Glycine, serine and threonine metabolism
schl00270  Cysteine and methionine metabolism
schl00680  Methane metabolism
schl01100  Metabolic pathways
schl01110  Biosynthesis of secondary metabolites
schl01120  Microbial metabolism in diverse environments
schl01200  Carbon metabolism
schl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:schl00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    QJS52_08165
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    QJS52_08165
   00270 Cysteine and methionine metabolism
    QJS52_08165
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:schl04147]
    QJS52_08165
Enzymes [BR:schl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     QJS52_08165
    1.1.1.399  2-oxoglutarate reductase
     QJS52_08165
Exosome [BR:schl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   QJS52_08165
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh
Other DBs
NCBI-ProteinID: XFP05493
LinkDB
Position
complement(6193826..6194791)
AA seq 321 aa
MSSALRVLLTDRAWPDAEIEKKILGAARAELVEATATDEATLIGLAKDVDAIATNWAHVT
EAVIRSAPRCRIVARLGIGIDNIAVSTATELGIPVTNCPDYCVSEVSDHALGLLLACARQ
IGFFHLRTKRGEYDLSAAGPMRRLSGQTVGLVGLGNTARELVPKLRALGLTVLSHTRSGA
DYGTGCRMVSLKELCEQSDYISIHAPLVPETRHLFNAERLRWMKPTAYLINTSRGGLIDP
AALWEALQKNVIAGAALDVFEPEPPDLNDPLYQDERVIVTPHAAFVSQESLDQMRTQAMN
QVVQALRGERPDNLVNPTYQA
NT seq 966 nt   +upstreamnt  +downstreamnt
atgtcgagtgctttacgtgtgctgttgacggaccgtgcctggcctgatgcggagattgaa
aagaagattctgggggccgccagggcagaactggttgaagcaactgccacggatgaagcg
acactcattggcctggcaaaagacgttgacgccattgcgacaaactgggctcacgtgacc
gaagcggttattcgaagtgcacctcgttgccgcatcgtcgcccggttggggatcggcatc
gacaatatcgccgtttctacggcaaccgaactgggaattccggtcacgaactgtccggat
tactgcgtatcagaggtttccgaccacgcactggggctgctgctggcatgtgcacggcag
atcggcttcttccatctgcgaacaaagcggggagaatacgatctgagtgctgccggaccg
atgcggcgactctcggggcagaccgtgggtctggtcggtctgggaaataccgccagagaa
ctcgttcccaagttgcgcgcgttggggctgacagtactgtctcacacacgatcgggggcg
gactacggcacgggctgtcgcatggtttcgttgaaggagctttgcgaacagagcgattac
atttcaatccatgctccactcgtccccgaaacgcggcatctgttcaatgccgagcggctg
aggtggatgaagccaacagcctatctcatcaacacgtcgcgcggcggattgatcgacccc
gcagcactctgggaagccctgcagaagaatgtcatcgccggagcggcccttgacgtgttc
gagcccgagccaccggatctcaatgatcccctctatcaggacgagcgggtgattgtcaca
ccccacgccgcatttgtgtcgcaggagtcacttgatcagatgcggacgcaggcgatgaat
caggttgttcaagccctgcgcggtgagcgaccggataatctggtcaatccgacctaccag
gcatag

DBGET integrated database retrieval system