KEGG   Sinorhizobium chiapasense: RB548_25350
Entry
RB548_25350       CDS       T11111                                 
Name
(GenBank) NADH-quinone oxidoreductase subunit J
  KO
K00339  NADH-quinone oxidoreductase subunit J [EC:7.1.1.2]
Organism
schp  Sinorhizobium chiapasense
Pathway
schp00190  Oxidative phosphorylation
schp01100  Metabolic pathways
Module
schp_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:schp00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RB548_25350
Enzymes [BR:schp01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     RB548_25350
SSDB
Motif
Pfam: Oxidored_q3 MbhD AveC_like
Other DBs
NCBI-ProteinID: WVT07502
UniProt: A0ABZ2BJ60
LinkDB
Position
pSchITTGS70d:138123..138623
AA seq 166 aa
MAQGFFLLFAAVSVITALTVVLARNPVHSALALMACFLQVSAIFVLLGAPLLAVIQIFVY
VGAIMVLFLFVIMMIDVREAVLQRFLPGGNLPALVLLVLLGVEMLVLVLWSDRFSMAEPV
AIRGGDEVRELSTTLFADYLLPFEAASVILLAALVGAIVLARKEPG
NT seq 501 nt   +upstreamnt  +downstreamnt
atggctcaggggttctttcttctgttcgctgcggtgtccgtgatcacggccctgactgtg
gtcctggcgcgcaatcccgttcacagcgcattggccctgatggcgtgtttcctgcaggtc
tcggcaatcttcgtcctgctcggggcgccattgctcgcggtcatccagatcttcgtctat
gtcggcgcgatcatggtcctgttcctgttcgtgatcatgatgatcgatgtgcgcgaagcg
gtattgcagcggttcttgccgggcggcaacctgccggctctcgtgctgctcgtcctgctc
ggcgtcgagatgcttgtactggtgctctggagcgaccgcttttcgatggcggaacctgtc
gccatccgtggcggcgatgaggtgagagagctcagcaccacccttttcgccgactatctc
ctgccgttcgaagccgcctccgtcatcctgctggccgcccttgtcggcgcgatcgtactg
gcgcggaaggagccggggtga

DBGET integrated database retrieval system