Siniperca chuatsi (mandarin fish): 122864869 Help Entry 122864869         CDS       T08948                                  Symbol s100a10a Name (RefSeq) protein S100-A10a   KO K17274   protein S100-A10 Organism schu  Siniperca chuatsi (mandarin fish) Pathway schu04382   Cornified envelope formation schu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:schu00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     122864869 (s100a10a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122864869 (s100a10a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:schu04147]     122864869 (s100a10a) Exosome [BR:schu04147]  Exosomal proteins   Exosomal proteins of microglial cells    122864869 (s100a10a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 EH SPARC_Ca_bdg Motif Other DBs NCBI-GeneID:  122864869 NCBI-ProteinID:  XP_044028533 LinkDB All DBs Position LG17:complement(10945897..10947698) Genome browser AA seq 99 aa AA seqDB search MPSELEGAMESLIKVFHRYASKDSRSGTLNRRELRELMENELSTFLKSQKDPAAVDKIMK DLDTNGDGQVDFEEFVSLIVGLSIACEQCYQLHLKMGRK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgccttcagaactggaaggagccatggagtcactcatcaaggtgttccaccgttacgcc tctaaggacagccggagtggcacactcaaccggcgagagctcagagagttgatggagaac gagctgtctaccttccttaagtctcagaaggaccctgctgctgtagacaaaatcatgaag gacctggacaccaacggtgatggccaggtggactttgaggagtttgtgtcactgattgtt ggactttccattgcctgtgagcagtgctatcagttgcacttgaagatgggaaggaagtaa

DBGET integrated database retrieval system