Siniperca chuatsi (mandarin fish): 122870413 Help Entry 122870413         CDS       T08948                                  Symbol cxcl19 Name (RefSeq) C-X-C motif chemokine 19   KO K10030   interleukin 8 Organism schu  Siniperca chuatsi (mandarin fish) Pathway schu04060   Cytokine-cytokine receptor interaction schu04218   Cellular senescence schu04620   Toll-like receptor signaling pathway schu04621   NOD-like receptor signaling pathway schu04622   RIG-I-like receptor signaling pathway schu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:schu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122870413 (cxcl19)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     122870413 (cxcl19)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122870413 (cxcl19)    04621 NOD-like receptor signaling pathway     122870413 (cxcl19)    04622 RIG-I-like receptor signaling pathway     122870413 (cxcl19)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122870413 (cxcl19)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:schu04052]     122870413 (cxcl19)    00536 Glycosaminoglycan binding proteins [BR:schu00536]     122870413 (cxcl19) Cytokines and neuropeptides [BR:schu04052]  Cytokines   Chemokines    122870413 (cxcl19) Glycosaminoglycan binding proteins [BR:schu00536]  Heparan sulfate / Heparin   Chemokines    122870413 (cxcl19) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 DUF6684 Motif Other DBs NCBI-GeneID:  122870413 NCBI-ProteinID:  XP_044040519 LinkDB All DBs Position LG22:15775647..15779546 Genome browser AA seq 141 aa AA seqDB search MITVHTHIGMQNVYKQSQQLYGICMIKNLTSSCVNMMKLCILLVFGTLFVVINGMPPISR DYNTHCRCLQVESRIIPPDNLRSIKLIPEGPHCPEIEVIAGLVNGEKVCLNPRSSWVKKL IHFVLERQLHQQGQALPKNKA NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atgatcactgtacatacacatattggaatgcagaatgtatataaacagtctcaacagctg tatggtatctgtatgataaagaacttaacaagcagctgcgtaaacatgatgaagctctgc attctgctcgtgtttgggaccctgtttgtcgtcattaacggtatgccgccaatcagcagg gactacaatacgcactgtcggtgcctgcaggtggagtcgaggatcatccctccagacaac ctgaggagcatcaagctcatccctgaagggccccactgcccggaaatagaagtcatagct ggactggtgaatggggagaaggtttgcttgaaccctcggtcttcctgggtgaagaagctg atccactttgttcttgagagacaactacatcagcagggacaagcacttcccaagaataaa gcataa

DBGET integrated database retrieval system