Siniperca chuatsi (mandarin fish): 122871800 Help Entry 122871800         CDS       T08948                                  Symbol dnal4b Name (RefSeq) dynein, axonemal, light chain 4b   KO K10412   dynein axonemal light chain 4 Organism schu  Siniperca chuatsi (mandarin fish) Pathway schu04814   Motor proteins Brite KEGG Orthology (KO) [BR:schu00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     122871800 (dnal4b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:schu03037]     122871800 (dnal4b)    04812 Cytoskeleton proteins [BR:schu04812]     122871800 (dnal4b) Cilium and associated proteins [BR:schu03037]  Motile cilia and associated proteins   Dynein arm    122871800 (dnal4b) Cytoskeleton proteins [BR:schu04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      122871800 (dnal4b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Ground-like Motif Other DBs NCBI-GeneID:  122871800 NCBI-ProteinID:  XP_044043127 LinkDB All DBs Position LG3:complement(6290035..6293431) Genome browser AA seq 106 aa AA seqDB search MAGTGEGKKEEADYKRLHSFPLIRHTDMPEEMRVETMELCVTACEKFATNNESAAKMIKE SMDKKFGSSWHVVIGEGFGFEVTHEVKNLLYMFFGGSLAVCVWKCS NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggctgggactggcgagggaaagaaagaggaggccgactacaagagactgcacagcttc cctctcatcaggcacacagacatgccagaagaaatgagggttgagaccatggagctctgt gttacagcctgcgaaaagtttgccaccaacaatgagagtgcagcaaagatgatcaaggag tccatggacaagaaattcggcagctcgtggcacgtggtgatcggtgaaggtttcggcttt gaggtcacacacgaagtgaagaacctgctctacatgttctttggagggagcctggccgtg tgtgtgtggaagtgctcgtag

DBGET integrated database retrieval system