Siniperca chuatsi (mandarin fish): 122873628 Help Entry 122873628         CDS       T08948                                  Symbol wdr83os Name (RefSeq) protein Asterix   KO K24963   PAT complex subunit Asterix Organism schu  Siniperca chuatsi (mandarin fish) Brite KEGG Orthology (KO) [BR:schu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:schu03110]     122873628 (wdr83os)    04131 Membrane trafficking [BR:schu04131]     122873628 (wdr83os) Chaperones and folding catalysts [BR:schu03110]  Other chaperones and cochaperones   Others    122873628 (wdr83os) Membrane trafficking [BR:schu04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    Multi-pass translocon (MPT) complex     122873628 (wdr83os) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ASTER Motif Other DBs NCBI-GeneID:  122873628 NCBI-ProteinID:  XP_044046530 LinkDB All DBs Position LG3:4445891..4449726 Genome browser AA seq 106 aa AA seqDB search MSSNNMADPRRQNKILRYKPPSTETNPTLEDPTPDYMNLLGMIFSMCGLMLKLKWCAWIA VYCSFISFANSRSSEDTKQMMSSFMLSISAVVMSYLQNPQPMSPPW NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgtcttccaacaatatggcagacccgaggagacaaaataagattttaaggtacaagccg cccagcacagagaccaatcccacactggaggaccccacgcccgactacatgaacctgctc ggcatgatcttcagcatgtgtggactgatgctcaagctgaagtggtgtgcctggatcgca gtctactgctctttcatcagctttgcaaactccagaagttcagaggacaccaaacagatg atgagcagcttcatgctgtccatctcagcagttgtgatgtcctacctccagaacccacag ccaatgtcgccgccatggtaa

DBGET integrated database retrieval system