Siniperca chuatsi (mandarin fish): 122873767 Help Entry 122873767         CDS       T08948                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism schu  Siniperca chuatsi (mandarin fish) Pathway schu04060   Cytokine-cytokine receptor interaction schu04218   Cellular senescence schu04620   Toll-like receptor signaling pathway schu04621   NOD-like receptor signaling pathway schu04622   RIG-I-like receptor signaling pathway schu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:schu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122873767  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     122873767  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122873767    04621 NOD-like receptor signaling pathway     122873767    04622 RIG-I-like receptor signaling pathway     122873767  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122873767  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:schu04052]     122873767    00536 Glycosaminoglycan binding proteins [BR:schu00536]     122873767 Cytokines and neuropeptides [BR:schu04052]  Cytokines   Chemokines    122873767 Glycosaminoglycan binding proteins [BR:schu00536]  Heparan sulfate / Heparin   Chemokines    122873767 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  122873767 NCBI-ProteinID:  XP_044046840 LinkDB All DBs Position LG3:16527923..16529319 Genome browser AA seq 99 aa AA seqDB search MKSSRVIITSIVVLLAFLAISEGMSLRSLGVEMHCRCIQTESKPIGRHIGKVELIPANSH CEETEIIATLKKTGQEVCLDPEAPWVKRVIQKIMSNKRR NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaagagcagcagagttatcatcacctctattgtggtgctcctggccttcctggccatc agtgaagggatgagcctgagaagcctgggagtggagatgcactgccgctgcatccagaca gagagcaaacccataggccgccacattgggaaggtggagctgattcctgccaactcccac tgcgaggagactgagatcattgccacccttaaaaagacaggccaagaggtttgcctggac ccagaggctccctgggtgaagagagtgattcagaagatcatgtccaacaaaagacgctga

DBGET integrated database retrieval system