Siniperca chuatsi (mandarin fish): 122875107 Help Entry 122875107         CDS       T08948                                  Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism schu  Siniperca chuatsi (mandarin fish) Pathway schu04010   MAPK signaling pathway schu04012   ErbB signaling pathway schu04068   FoxO signaling pathway schu04137   Mitophagy - animal schu04140   Autophagy - animal schu04144   Endocytosis schu04150   mTOR signaling pathway schu04210   Apoptosis schu04218   Cellular senescence schu04370   VEGF signaling pathway schu04371   Apelin signaling pathway schu04510   Focal adhesion schu04540   Gap junction schu04625   C-type lectin receptor signaling pathway schu04810   Regulation of actin cytoskeleton schu04910   Insulin signaling pathway schu04912   GnRH signaling pathway schu04916   Melanogenesis schu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:schu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122875107    04012 ErbB signaling pathway     122875107    04370 VEGF signaling pathway     122875107    04371 Apelin signaling pathway     122875107    04068 FoxO signaling pathway     122875107    04150 mTOR signaling pathway     122875107  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     122875107    04140 Autophagy - animal     122875107    04137 Mitophagy - animal     122875107   09143 Cell growth and death    04210 Apoptosis     122875107    04218 Cellular senescence     122875107   09144 Cellular community - eukaryotes    04510 Focal adhesion     122875107    04540 Gap junction     122875107   09142 Cell motility    04810 Regulation of actin cytoskeleton     122875107  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     122875107   09152 Endocrine system    04910 Insulin signaling pathway     122875107    04912 GnRH signaling pathway     122875107    04916 Melanogenesis     122875107  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122875107  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:schu04131]     122875107   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:schu04147]     122875107    04031 GTP-binding proteins [BR:schu04031]     122875107 Membrane trafficking [BR:schu04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     122875107  Endocytosis   Macropinocytosis    Ras GTPases     122875107 Exosome [BR:schu04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    122875107   Exosomal proteins of colorectal cancer cells    122875107 GTP-binding proteins [BR:schu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     122875107 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  122875107 NCBI-ProteinID:  XP_044049833 LinkDB All DBs Position LG4:17863287..17879263 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagctggtggtggtgggcgctggaggcgtggggaagagtgcactcacc atccaactcatccagaaccactttgtggatgaatatgaccccaccatagaggactcgtac aggaaacaggttgtgattgatggggagacctgcctgctggacatcctggacactgcaggt caagaggagtacagcgccatgagggatcagtacatgaggacaggggagggtttcctctgc gtctttgccatcaacaacaccaagtcttttgaggatattcatcagtacagagaacagatt aaacgtgtaaaggactcagacgatgttcccatggtgctcgtgggaaacaaatgtgacctc ccggcacgcacggtggacacaaggcaagcccaggaactcgcccgctcctacggcatccct tacatcgagacctctgccaagacacgacagggagtggaggacgctttctacacactggtt agggagatcagacagcataagctgaggaagctgaacccacctgatgagagcggtcaggac tgtatgagctgtcgctgtgtggtatcgtga

DBGET integrated database retrieval system