Siniperca chuatsi (mandarin fish): 122877996 Help Entry 122877996         CDS       T08948                                  Symbol ccl25b Name (RefSeq) C-C motif chemokine 25b   KO K13072   C-C motif chemokine 25 Organism schu  Siniperca chuatsi (mandarin fish) Pathway schu04060   Cytokine-cytokine receptor interaction schu04672   Intestinal immune network for IgA production Brite KEGG Orthology (KO) [BR:schu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122877996 (ccl25b)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     122877996 (ccl25b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:schu04052]     122877996 (ccl25b) Cytokines and neuropeptides [BR:schu04052]  Cytokines   Chemokines    122877996 (ccl25b) SSDB OrthologParalogGFIT Motif Pfam:  IL8 Peptidase_C65 Motif Other DBs NCBI-GeneID:  122877996 NCBI-ProteinID:  XP_044056199 LinkDB All DBs Position LG6:17771706..17775458 Genome browser AA seq 100 aa AA seqDB search MKFQALFFLLLLTCMYLSLAQGSYGNCCLGYVQGMKANAKKNIESYRMQETDGDCNIRAV VFLMKKRPSHKKQRTVCANPSTGWVRDLIETVNMRMSKQN NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgaagtttcaagctcttttctttcttctgctcctcacctgcatgtacctgagtctggcg caaggctcttatggcaactgctgccttggctatgttcaagggatgaaagcaaatgcaaag aaaaacattgaaagttacaggatgcaggaaacagatggtgattgcaacatcagagctgtt gtgtttctgatgaagaagaggccttcacataaaaaacaacggactgtctgcgccaatcca agcactggttgggtccgggacctgattgagactgtgaatatgaggatgtcaaagcagaat tag

DBGET integrated database retrieval system