Siniperca chuatsi (mandarin fish): 122880879 Help Entry 122880879         CDS       T08948                                  Symbol insb Name (RefSeq) preproinsulin b   KO K04526   insulin Organism schu  Siniperca chuatsi (mandarin fish) Pathway schu04010   MAPK signaling pathway schu04068   FoxO signaling pathway schu04081   Hormone signaling schu04114   Oocyte meiosis schu04140   Autophagy - animal schu04150   mTOR signaling pathway schu04810   Regulation of actin cytoskeleton schu04910   Insulin signaling pathway schu04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:schu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122880879 (insb)    04068 FoxO signaling pathway     122880879 (insb)    04150 mTOR signaling pathway     122880879 (insb)   09133 Signaling molecules and interaction    04081 Hormone signaling     122880879 (insb)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122880879 (insb)   09143 Cell growth and death    04114 Oocyte meiosis     122880879 (insb)   09142 Cell motility    04810 Regulation of actin cytoskeleton     122880879 (insb)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     122880879 (insb)    04914 Progesterone-mediated oocyte maturation     122880879 (insb)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:schu04052]     122880879 (insb) Cytokines and neuropeptides [BR:schu04052]  Neuropeptides   Unclassified    122880879 (insb) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta CoA_binding_3 Motif Other DBs NCBI-GeneID:  122880879 NCBI-ProteinID:  XP_044062361 LinkDB All DBs Position LG8:complement(21265623..21272040) Genome browser AA seq 111 aa AA seqDB search MARVLWAVSMLLLLVLHSPGVSSAPAQHLCGSHLVDALYFVCGERGFFYSPNQPHKRDLE HLLGILSKRARQEQRLWRALSGRDEPKVKRGIVEQCCHKPCSIYHLEGYCN NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggccagggtactgtgggcggtgtccatgctgttactgctggtgctccactctccaggg gtgtcctcggcccccgcccagcacctgtgtggctcccacctggtggacgccctctacttt gtatgtggagaacggggctttttctacagtccaaaccagccccacaagcgggatctggaa catctgctcgggatcctgtcgaaaagggcccgacaggagcagcgtctgtggagggctctg tctggccgcgatgagcccaaggtgaagagaggcatcgtggagcagtgctgccataagcca tgcagcatttaccacctggagggctactgcaactga

DBGET integrated database retrieval system