Siniperca chuatsi (mandarin fish): 122882025 Help Entry 122882025         CDS       T08948                                  Symbol pole3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism schu  Siniperca chuatsi (mandarin fish) Pathway schu03030   DNA replication schu03082   ATP-dependent chromatin remodeling schu03410   Base excision repair schu03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:schu00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     122882025 (pole3)    03410 Base excision repair     122882025 (pole3)    03420 Nucleotide excision repair     122882025 (pole3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     122882025 (pole3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:schu03032]     122882025 (pole3)    03036 Chromosome and associated proteins [BR:schu03036]     122882025 (pole3)    03400 DNA repair and recombination proteins [BR:schu03400]     122882025 (pole3) Enzymes [BR:schu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      122882025 (pole3) DNA replication proteins [BR:schu03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     122882025 (pole3) Chromosome and associated proteins [BR:schu03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     122882025 (pole3) DNA repair and recombination proteins [BR:schu03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       122882025 (pole3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C CIS_TMP PPP4R2 BUD22 SpoU_methylase DUF4746 DUF5427 RNA_pol_3_Rpc31 DUF3276 PFF1_TM CDC45 DDHD V_ATPase_I Nop52 Motif Other DBs NCBI-GeneID:  122882025 NCBI-ProteinID:  XP_044064880 LinkDB All DBs Position LG1:3392790..3398624 Genome browser AA seq 152 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPDGVNVSKEARRAISQAASVFVLYATSCANNFAMKAK RKTLNAGDVLAAMEEMEFERFLEPLREALEVYKKGQKGKKEVSEQKRKDKEKKADSEHDR SREEEEEEEEEQERMEEEPEAEEEEEEEEVEN NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atggcagagaggccagaagatctgaaccttcccaacgcggtaatcacccgcatcatcaag gaggcgctcccagatggggtgaatgtgtcgaaagaagcaaggagggccatatcccaagct gccagtgtgttcgtgttgtatgcaacgtcctgtgcaaacaactttgccatgaaagccaag cggaaaactctgaacgcaggagacgttttggctgcgatggaggaaatggagtttgagcgt ttcctggagcctctcagagaagctttggaagtgtacaagaagggccagaaaggaaagaag gaggtgtctgagcagaagcgcaaagataaagagaagaaggccgactctgagcacgacagg agcagggaggaggaagaggaggaggaggaagagcaggagcgcatggaggaggagcctgaa gctgaggaggaggaagaggaggaggaggtggagaactga

DBGET integrated database retrieval system