Siniperca chuatsi (mandarin fish): 122882174 Help Entry 122882174         CDS       T08948                                  Symbol s100a10b Name (RefSeq) protein S100-A10b   KO K17274   protein S100-A10 Organism schu  Siniperca chuatsi (mandarin fish) Pathway schu04382   Cornified envelope formation schu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:schu00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     122882174 (s100a10b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122882174 (s100a10b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:schu04147]     122882174 (s100a10b) Exosome [BR:schu04147]  Exosomal proteins   Exosomal proteins of microglial cells    122882174 (s100a10b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_1 SPARC_Ca_bdg Motif Other DBs NCBI-GeneID:  122882174 NCBI-ProteinID:  XP_044065212 LinkDB All DBs Position LG9:complement(13339878..13342063) Genome browser AA seq 98 aa AA seqDB search MTELETCMESLIKIFHRYADEDGDGKTLSKKELKKLVETELPTFLKCQKNPKTVDCILKD LDQNKDDKLDFEEFLPLVAGLSMACEKCYVLYEKKGKK NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgactgagttggagacttgcatggagtccctgattaagatatttcaccgctatgctgat gaagatggtgatggaaagaccttaagcaagaaggaactgaaaaaactagttgagactgag ttacccaccttcctgaaatgccagaagaaccccaaaactgtggactgcatcttgaaagat ttggaccaaaacaaagatgataagttggactttgaagaatttcttcccctcgtcgccggc ctctcaatggcctgtgagaagtgttacgtgctctatgagaagaagggcaagaagtga

DBGET integrated database retrieval system