Siniperca chuatsi (mandarin fish): 122885334 Help Entry 122885334         CDS       T08948                                  Symbol cenps Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism schu  Siniperca chuatsi (mandarin fish) Pathway schu03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:schu00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     122885334 (cenps)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:schu03036]     122885334 (cenps)    03400 DNA repair and recombination proteins [BR:schu03400]     122885334 (cenps) Chromosome and associated proteins [BR:schu03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      122885334 (cenps) DNA repair and recombination proteins [BR:schu03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      122885334 (cenps) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C DUF7229 Serine_rich Histone TFIID-31kDa Bromo_TP Motif Other DBs NCBI-GeneID:  122885334 NCBI-ProteinID:  XP_044072223 LinkDB All DBs Position LG2:complement(15324698..15328148) Genome browser AA seq 122 aa AA seqDB search MSVDKDETQQRLKAAVHYTVGRLCQKIGEDHRREFSRQVIAAIAETTFRQCDIFAKDLEA FARHAKRSTASAEDVKLVARRSTALSIYIQNKSEELNQEQRDLKKKNTGKRKSRDTEEES RE NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgtctgttgataaagacgagacccaacagaggttaaaggcagcagtccattatactgtg gggcgcctgtgtcagaagatcggagaggaccaccggagagagttcagtcgacaagtcata gcagcaatagccgagacaactttcagacaatgtgatatatttgctaaagacctggaagcc tttgcaaggcatgctaaaagaagcacagcgtctgcggaagatgtaaagcttgtagcccgt cgcagtactgcattgtccatctacatacaaaataaaagtgaagaactgaaccaggagcag agggatttgaaaaagaagaatactgggaagaggaagagcagagacactgaggaggaaagc agagaataa

DBGET integrated database retrieval system