Siniperca chuatsi (mandarin fish): 122888759 Help Entry 122888759         CDS       T08948                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism schu  Siniperca chuatsi (mandarin fish) Pathway schu04137   Mitophagy - animal schu04140   Autophagy - animal schu04144   Endocytosis schu04145   Phagosome schu04148   Efferocytosis schu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:schu00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     122888759    04145 Phagosome     122888759    04140 Autophagy - animal     122888759    04137 Mitophagy - animal     122888759    04148 Efferocytosis     122888759  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122888759  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:schu04131]     122888759   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:schu04147]     122888759    04031 GTP-binding proteins [BR:schu04031]     122888759 Membrane trafficking [BR:schu04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     122888759 Exosome [BR:schu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122888759   Exosomal proteins of other body fluids (saliva and urine)    122888759   Exosomal proteins of colorectal cancer cells    122888759   Exosomal proteins of bladder cancer cells    122888759 GTP-binding proteins [BR:schu04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     122888759 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  122888759 NCBI-ProteinID:  XP_044079519 LinkDB All DBs Position LG2:25584402..25590050 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRSERAKPSAETCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacgtcaaggaagaaagtactactcaaagtcatcatccttggagactccggagttggg aagacctctttgatgaaccagtatgtgaataagaagttcagtaaccagtacaaagccaca ataggggctgatttcctgacgaaagaagtcatggtggatgacagacttgtcacaatgcag atttgggacacagcaggtcaggagaggttccagtccttaggcgtggcgttctaccgcggc gcagactgctgtgtcctggtgtttgacgtgacagcaccaaacaccttcaagactctagac agctggagggacgagttcttgatccaggccagcccccgagacccggagaatttccccttt gtggtgctgggcaacaagatcgacttggagaacagacaggtaacaaccaagcgagcacag gcttggtgtcagagcaagaacaacatcccctatttcgaaaccagcgccaaggaggcaatc aacgtggagcaggccttccagactattgcacgcaacgctcttaaacaggagactgaagtg gagttgtacaacgagttccctgagccgataaagctggacaggagcgagcgagccaagccg tcagcggagacctgcagctgctga

DBGET integrated database retrieval system