Candidatus Sumerlaea chitinivorans: BRCON_0316 Help Entry BRCON_0316        CDS       T09023                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism schv  Candidatus Sumerlaea chitinivorans Pathway schv01100   Metabolic pathways schv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:schv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BRCON_0316    00074 Mycolic acid biosynthesis     BRCON_0316   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BRCON_0316 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Fas_alpha_ACP Ribosomal_L50 Ribosomal_L12_N DUF1493 DUF7080 Motif Other DBs NCBI-ProteinID:  AXA35093 UniProt:  A0A2Z4Y3A6 LinkDB All DBs Position 360643..360888 Genome browser AA seq 81 aa AA seqDB search MSVEQKVREIVAQQLGKNVDQVTPEASFRDDLGADSLDVVELVMALEEEFGVEIPDEDAE KIQTVGQAIDYLKEKVGSSEG NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgtcggttgaacagaaggtccgcgaaatcgtggcccaacaactgggaaagaatgtggat caggtaacacctgaggcgtcgttccgggatgaccttggagccgactctctcgacgtggtc gagctcgtgatggcgctcgaggaagagttcggcgtggaaatccccgacgaagatgcagag aaaatccagacggtcggccaagcgattgattatctgaaagagaaggttggctcgtcggaa ggctaa

DBGET integrated database retrieval system