Sphingomonas changnyeongensis: GVO57_04995 Help Entry GVO57_04995       CDS       T07798                                  Name (GenBank) ATP synthase F1 subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism schy  Sphingomonas changnyeongensis Pathway schy00190   Oxidative phosphorylation schy01100   Metabolic pathways Module schy_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:schy00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     GVO57_04995  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:schy00194]     GVO57_04995 Photosynthesis proteins [BR:schy00194]  Photosystem and electron transport system   F-type ATPase [OT]    GVO57_04995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  QHL90309 UniProt:  A0A7Z2NVS1 LinkDB All DBs Position complement(981269..981523) Genome browser AA seq 84 aa AA seqDB search MPLHFELVTPEKLVRSEDVHMVTVPGTEGDFGVLEGHAPFVSTLRDGVLLVFAAPGAEPV AIPVEGGFAEINDRGLTVLADRAG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcccctgcatttcgaactcgtgaccccggaaaagctcgtgcggtccgaagacgtccat atggtgacggtgcccggcaccgagggcgatttcggcgtgctcgaaggccatgcgcccttc gtctcgacgctgcgcgacggcgtgttgctggtgttcgccgcgccgggcgcggagccggtg gcgatccccgtcgaaggcggctttgccgagatcaatgatcgcgggctgacggtgctcgcc gaccgggcgggctga

DBGET integrated database retrieval system