Sphingomonas changnyeongensis: GVO57_05545 Help Entry GVO57_05545       CDS       T07798                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism schy  Sphingomonas changnyeongensis Pathway schy01100   Metabolic pathways schy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:schy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GVO57_05545    00074 Mycolic acid biosynthesis     GVO57_05545   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GVO57_05545 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QHL90399 UniProt:  A0A7Z2NVY3 LinkDB All DBs Position complement(1107195..1107449) Genome browser AA seq 84 aa AA seqDB search MSDRQQILDTVTRLIEPFNKKGVALAEGITFAGDLEWDSLTVMDFVAAIEDEFDIIITMN MQAEIETVGQLVDAVAKLKDGGNG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgtccgaccgtcagcagatcctcgacaccgtcacccgcctgatcgagccgttcaacaaa aagggcgtcgccctggccgaaggcatcacctttgccggcgaccttgaatgggacagcctg acggtgatggatttcgtcgccgcgatcgaggacgagttcgacatcatcatcacgatgaac atgcaggcggagatcgaaaccgtcggccagctggtcgacgcggtcgccaagctgaaggac ggcggcaatggctga

DBGET integrated database retrieval system