Streptomyces collinus: B446_12470 Help Entry B446_12470        CDS       T02787                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sci  Streptomyces collinus Pathway sci00998   Biosynthesis of various antibiotics sci01100   Metabolic pathways sci01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sci00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B446_12470 (acpP)    00074 Mycolic acid biosynthesis     B446_12470 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B446_12470 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AGS69316 UniProt:  S5UU10 LinkDB All DBs Position 2879966..2880214 Genome browser AA seq 82 aa AA seqDB search MAATQEEIVAGLAEIVNEIAGIPTEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDATSYILKHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcgtcgccggtctcgccgagatcgtgaacgagatcgcc gggatccccaccgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaggagcgcttcgacgtgaagatcccg gacgaggacgtcaagaacctcaagaccgttggtgacgccaccagctacatcctcaagcac caggcctga

DBGET integrated database retrieval system