KEGG   Streptomyces collinus: B446_28660
Entry
B446_28660        CDS       T02787                                 

Definition
(GenBank) hypothetical protein
  KO
K18686  cyclooctat-9-en-7-ol synthase [EC:4.2.3.146]
Organism
sci  Streptomyces collinus
Pathway
sci00999  Biosynthesis of various secondary metabolites - part 1
sci01100  Metabolic pathways
sci01110  Biosynthesis of secondary metabolites
Module
sci_M00921  Cyclooctatin biosynthesis, dimethylallyl-PP + isopentenyl-PP => cyclooctatin
Brite
KEGG Orthology (KO) [BR:sci00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00999 Biosynthesis of various secondary metabolites - part 1
    B446_28660
Enzymes [BR:sci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.146  cyclooctat-9-en-7-ol synthase
     B446_28660
SSDB
Motif
Pfam: Terpene_syn_C_2 DUF1702
Other DBs
NCBI-ProteinID: AGS72538
UniProt: S5UYZ4
LinkDB
Position
complement(6630023..6630940)
AA seq 305 aa
MTADLTVPTATAPAGAARYWQESTDRFAALLDRHVGYEAQKVAMTEAELREVIDACNRAV
APLGKTVSDKRWISYMDVVRWSQSARHIKDREAFKAVCVLNCVTFVWDDMDAALHDFGLF
LPQLRAVCERYYSPEDAGFAYEGARAFVTSDHMFRDTRLKEVLCGTSPEQYFRFRVTDVG
VDFWMRMSYPIYRHRELTEHSRTGLAARMTTRGLAIVNDFYSYDREQAQGQTTNCFRLCD
MSDEADFRRFFQDRLDDMAEDMECIRAFDDVTRDVLLDLIQGNFVWTTRDRRYQAPVNDV
NSLIR
NT seq 918 nt   +upstreamnt  +downstreamnt
atgaccgcggacctgaccgtccccaccgccacggcgcccgcgggcgccgcccgctactgg
caggagagcaccgaccggttcgccgccctcctcgaccgccacgtcgggtacgaggcccag
aaggtggcgatgacggaggcggagctgcgcgaggtcatcgacgcctgcaaccgcgcggtc
gccccgctgggcaagaccgtctcggacaagcgctggatctcctacatggatgtcgtgcgc
tggtcccagagcgcccgtcacatcaaggacagggaggctttcaaggccgtctgcgtgctc
aactgcgtgaccttcgtgtgggacgacatggacgccgccctgcacgacttcggcctcttc
ctgccgcagctgcgcgcggtgtgtgagcggtactactcccccgaggacgccggcttcgcc
tacgagggcgcccgcgccttcgtcaccagtgaccacatgttccgcgacacccggctcaag
gaggtgctctgcggcacctcgcccgagcagtacttccgcttccgcgtcaccgacgtcggg
gtggacttctggatgcggatgtcgtacccgatctaccgccaccgcgagttgaccgagcac
tcgaggacgggcctcgccgcccgcatgaccacgcgcgggctggccatcgtcaacgacttc
tactcctacgaccgtgagcaggcccagggccagaccaccaactgcttccggctgtgcgac
atgagcgacgaggccgacttccggcgcttcttccaggaccgcctcgacgacatggccgag
gacatggagtgcatccgggcgttcgacgacgtgacccgggacgtcctgctggacctcatc
cagggcaacttcgtgtggaccacccgcgaccggcgctaccaggcgccggtgaacgacgtc
aactcgctcatccggtag

DBGET integrated database retrieval system