Streptomyces cinereoruber: CP977_03865
Help
Entry
CP977_03865 CDS
T07115
Name
(GenBank) DUF2975 domain-containing protein
Organism
scin
Streptomyces cinereoruber
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
DUF2975
Motif
Other DBs
NCBI-ProteinID:
QEV31410
UniProt:
A0AAV4KKF9
LinkDB
All DBs
Position
complement(862005..862502)
Genome browser
AA seq
165 aa
AA seq
DB search
MGKLTVLALRAVLAGLLAGSVFVEAVMVPLLAADLNGLRPEYAYLRTPVLVLLVLGALTA
QTVLVCVWRLVTMVRRGTVFSHAAFRYVDVVTGAFAAGAALVFAFAVLLAPGEAAAPGVV
LLICGASLAVLGVALIVLVLRMLLAQAVEREAEAKRMRAELAEVI
NT seq
498 nt
NT seq
+upstream
nt +downstream
nt
atgggaaagctgacggtgctcgcgctgcgcgccgtgctcgcgggactgctcgcgggttcg
gtcttcgtggaggcggtgatggtgccgctcctggccgccgacctgaacgggctgaggccg
gagtacgcgtacctccgcacaccggtgctcgtgctcctggtcctgggcgcgctgacggca
cagaccgtcctggtctgcgtgtggcggctcgtgacgatggtgcggcgcggcacggtgttc
tcgcacgcggccttccggtacgtggacgtcgtcaccggcgccttcgccgcgggcgccgcc
ctggtcttcgcgttcgccgtgctcctcgcgcccggcgaggccgccgccccgggcgtcgtg
ctcctgatctgcggggcgagcctggcggtcctgggcgtggccctgatcgtgctcgtgctg
cggatgctgctcgcccaggccgtcgagcgcgaggccgaggcgaagcggatgcgggccgag
ctcgccgaggtgatctga
DBGET
integrated database retrieval system