Streptomyces cinereoruber: CP977_27935 Help Entry CP977_27935       CDS       T07115                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism scin  Streptomyces cinereoruber Pathway scin00253   Tetracycline biosynthesis scin01056   Biosynthesis of type II polyketide backbone scin01100   Metabolic pathways scin01110   Biosynthesis of secondary metabolites Module scin_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:scin00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     CP977_27935    00253 Tetracycline biosynthesis     CP977_27935  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:scin01004]     CP977_27935    01008 Polyketide biosynthesis proteins [BR:scin01008]     CP977_27935 Lipid biosynthesis proteins [BR:scin01004]  Polyketide synthase   Component type    CP977_27935 Polyketide biosynthesis proteins [BR:scin01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      CP977_27935     Nonaketide PKS      CP977_27935     Decaketide PKS      CP977_27935 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1780 Motif Other DBs NCBI-ProteinID:  QEV35535 LinkDB All DBs Position 6196960..6197217 Genome browser AA seq 85 aa AA seqDB search MAKELTAERLFGILRECAGEEEYVTGSESALDVEFTELGYDSLALLETTARVSREYRVEI PEEELADVRTPAAFLKTVNRLLAVA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcgaaggaactgaccgccgagcgactcttcgggatcctgcgcgaatgtgcgggagaa gaggaatacgtcaccggatcggaaagtgcgctcgacgtggagttcaccgagctggggtac gactccctggccctcctggagaccaccgcccgggtctcccgggagtaccgggtggagatc ccggaggaggagctggcggacgtgcggacgccggccgcttttttgaagaccgtcaaccgg ctgctggccgtggcgtga

DBGET integrated database retrieval system