Streptomyces cinnabarinus: STRCI_000661 Help Entry STRCI_000661      CDS       T08957                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism scir  Streptomyces cinnabarinus Pathway scir00998   Biosynthesis of various antibiotics scir01100   Metabolic pathways scir01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scir00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     STRCI_000661 (acpP)    00074 Mycolic acid biosynthesis     STRCI_000661 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     STRCI_000661 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WAZ19600 UniProt:  A0ABY7K728 LinkDB All DBs Position complement(701284..701550) Genome browser AA seq 88 aa AA seqDB search MTTVLDRVTQILVSHLGVDEGQVTPDTSFKELGMDSLDLVEIVIRFEEEFASEADSGDEL EITDDQARKIATVDDAVTYLKSRGIQDR NT seq 267 nt NT seq  +upstreamnt  +downstreamnt gtgactaccgttctcgaccgggtgacccagatcctcgtctcccatctcggcgtggacgaa gggcaggtgacacccgacacgagcttcaaggagctcggcatggactcgctggacctggtg gagatcgtcatccgcttcgaggaggagttcgcctcggaggccgacagcggcgacgagttg gagatcaccgacgaccaggcacggaagatcgcgaccgtggacgacgcggtcacctacctc aagtcccgtggcatacaggaccgctag

DBGET integrated database retrieval system