Streptomyces cinnabarinus: STRCI_006080 Help Entry STRCI_006080      CDS       T08957                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism scir  Streptomyces cinnabarinus Pathway scir00253   Tetracycline biosynthesis scir01056   Biosynthesis of type II polyketide backbone scir01100   Metabolic pathways scir01110   Biosynthesis of secondary metabolites Module scir_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:scir00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     STRCI_006080    00253 Tetracycline biosynthesis     STRCI_006080  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:scir01004]     STRCI_006080    01008 Polyketide biosynthesis proteins [BR:scir01008]     STRCI_006080 Lipid biosynthesis proteins [BR:scir01004]  Polyketide synthase   Component type    STRCI_006080 Polyketide biosynthesis proteins [BR:scir01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      STRCI_006080     Nonaketide PKS      STRCI_006080     Decaketide PKS      STRCI_006080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WAZ24641 LinkDB All DBs Position 6687501..6687773 Genome browser AA seq 90 aa AA seqDB search MPTEITLDDLTTLLRDCAGADDTVDLDGDILDKTFTELNYDSLAVLQTTGKIEREYGIEV DEDAVAVAETPRQYLAAVNAAFATDGAATA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgccgactgaaatcaccctcgacgatctgaccacgctgctccgggactgcgcaggagcg gacgacacggtcgacctggacggcgacatcctcgacaagacgttcaccgagctgaactac gactccctggccgtgctccagaccaccggcaagatcgagcgggagtacggcatcgaggtc gacgaggacgccgtcgcggtcgcggagaccccccgccagtacctcgccgcggtcaacgcg gcgttcgccaccgacggggcggcgactgcctga

DBGET integrated database retrieval system