Streptomyces cinnabarinus: STRCI_006102 Help Entry STRCI_006102      CDS       T08957                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism scir  Streptomyces cinnabarinus Pathway scir00253   Tetracycline biosynthesis scir01056   Biosynthesis of type II polyketide backbone scir01100   Metabolic pathways scir01110   Biosynthesis of secondary metabolites Module scir_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:scir00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     STRCI_006102    00253 Tetracycline biosynthesis     STRCI_006102  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:scir01004]     STRCI_006102    01008 Polyketide biosynthesis proteins [BR:scir01008]     STRCI_006102 Lipid biosynthesis proteins [BR:scir01004]  Polyketide synthase   Component type    STRCI_006102 Polyketide biosynthesis proteins [BR:scir01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      STRCI_006102     Nonaketide PKS      STRCI_006102     Decaketide PKS      STRCI_006102 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WAZ24660 LinkDB All DBs Position 6707927..6708202 Genome browser AA seq 91 aa AA seqDB search MTLSESPSPGFTLADLLRLLGESAGIPEGIDLAAEDVVDTPFYRLGYDSLALLQVTGRLK REYGLMLPDTIVADAPTPRALLTVIAQARAA NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaccctgtccgaatccccttcgcccggcttcaccctcgccgatctgctccggctgctg ggcgagagcgccggtatccccgagggcatcgacctggcggccgaggacgtcgtggacacg ccgttctaccggctcggctacgactcgctcgcgctgctccaggtgaccggccggctcaag cgggagtacgggctgatgctgcccgacacgatcgtcgccgacgccccgaccccgcgcgcc ctgctcaccgtcatcgcgcaggcgcgtgccgcctga

DBGET integrated database retrieval system