Streptomyces citrinus: V2W30_03220 Help Entry V2W30_03220       CDS       T11106                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism scit  Streptomyces citrinus Pathway scit00253   Tetracycline biosynthesis scit01056   Biosynthesis of type II polyketide backbone scit01100   Metabolic pathways scit01110   Biosynthesis of secondary metabolites Module scit_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:scit00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     V2W30_03220    00253 Tetracycline biosynthesis     V2W30_03220  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:scit01004]     V2W30_03220    01008 Polyketide biosynthesis proteins [BR:scit01008]     V2W30_03220 Lipid biosynthesis proteins [BR:scit01004]  Polyketide synthase   Component type    V2W30_03220 Polyketide biosynthesis proteins [BR:scit01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      V2W30_03220     Nonaketide PKS      V2W30_03220     Decaketide PKS      V2W30_03220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 DUF2958 Motif Other DBs NCBI-ProteinID:  WWQ62473 LinkDB All DBs Position complement(658760..659017) Genome browser AA seq 85 aa AA seqDB search MSTITLNDLRQILAVCAGEDEDTAFDGTDLDTPFTDLGYDSLAMLETAAHVTQRFGVEID DTELSDLRTPRQFLDGVNEVLARAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagcacgatcaccctgaacgacctccggcagatcctcgccgtgtgcgccggcgaggac gaggacaccgccttcgacggaaccgacctcgacaccccgttcaccgacctcggatacgac tcgctcgccatgctggagacggcggcccatgtcacccagcgattcggagtggagatcgac gacaccgagttgtcggatctgcggaccccgcggcagttcctcgacggcgtgaacgaggtg ctcgcccgagccgcctga

DBGET integrated database retrieval system