Streptomyces citrinus: V2W30_26910 Help Entry V2W30_26910       CDS       T11106                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism scit  Streptomyces citrinus Pathway scit00998   Biosynthesis of various antibiotics scit01100   Metabolic pathways scit01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scit00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     V2W30_26910    00074 Mycolic acid biosynthesis     V2W30_26910   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     V2W30_26910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WWQ66606 LinkDB All DBs Position 5765297..5765572 Genome browser AA seq 91 aa AA seqDB search MTAQTVRTEQDLHERVSRIVIEELELEDGELTEGGHFIDDYESDSLSLITVVSRIEKELG VAIPKTELGDLVNLRLLVAAVAQHSAGNADA NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaccgcgcagaccgtacggaccgagcaggacctccacgagcgggtgagccggatcgtc atcgaggaactggaactggaggacggcgaactcaccgagggcggccacttcatcgacgac tacgagagcgactcgctctccctcatcacggtggtctcccgcatcgagaaggaactcggt gtggccatccccaagaccgaactcggcgacctggtgaacctgcgcctgctggtcgccgcc gtcgcccagcacagcgccgggaacgcggatgcctga

DBGET integrated database retrieval system