Spiroplasma citri: SCITRI_001486 Help Entry SCITRI_001486     CDS       T04628                                  Symbol hupB Name (GenBank) DNA-binding protein HU-beta   KO K03530   DNA-binding protein HU-beta Organism sck  Spiroplasma citri Brite KEGG Orthology (KO) [BR:sck00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sck03032]     SCITRI_001486 (hupB)    03036 Chromosome and associated proteins [BR:sck03036]     SCITRI_001486 (hupB)    03400 DNA repair and recombination proteins [BR:sck03400]     SCITRI_001486 (hupB) DNA replication proteins [BR:sck03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     SCITRI_001486 (hupB) Chromosome and associated proteins [BR:sck03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     SCITRI_001486 (hupB) DNA repair and recombination proteins [BR:sck03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       SCITRI_001486 (hupB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_euk_1 HU-HIG Urease_beta GNC1_N Motif Other DBs NCBI-ProteinID:  APE75361 UniProt:  Q14MP3 LinkDB All DBs Position complement(1227355..1227639) Genome browser AA seq 94 aa AA seqDB search MSKKELAAQIAEKFTDVLSKTHAEEITNFVFDHIKKALVAGKEVSIAGFGKFAVTERAAR DGRNPSTGETIKIPASKSAKFKAGKQLKTDLNNN NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaaaaagaactagcagcgcaaattgccgaaaaatttactgatgtgttatcaaaa acacatgcagaagaaattacaaattttgtttttgatcatattaaaaaagctttagttgct ggaaaagaagtctcaattgcaggatttgggaaatttgctgtaaccgaaagagcagcaaga gatggaagaaatccgtcaacaggagaaacaattaaaattccagcttctaaatcagctaaa tttaaagcaggtaaacaattaaaaactgatttaaacaataattaa

DBGET integrated database retrieval system