Sorangium cellulosum So ce56: sce1465 Help Entry sce1465           CDS       T00634                                  Symbol acpP1 Name (GenBank) Hypothetical protein   KO K02078   acyl carrier protein Organism scl  Sorangium cellulosum So ce56 Pathway scl00998   Biosynthesis of various antibiotics scl01100   Metabolic pathways scl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     sce1465 (acpP1)    00074 Mycolic acid biosynthesis     sce1465 (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     sce1465 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  CAN91623 UniProt:  A9FC41 LinkDB All DBs Position 2011080..2011367 Genome browser AA seq 95 aa AA seqDB search MAGGGDPEIAREVRTIIAERCGMSVDAVTPDLSLESGLGVDSLALIEVNVALEERFQIVA PDFAAPDQAQISTVGDVIAFVEAQIAARGGRGGAP NT seq 288 nt NT seq  +upstreamnt  +downstreamnt gtggcgggcgggggagatcctgagatcgccagagaggtccgtaccatcattgcagagcga tgtgggatgagcgtcgatgccgtgactcccgacctgtcgctcgagagcggcctcggcgtg gattcactggcgctcatcgaggtcaacgtcgcgctcgaggagcgattccagatcgtggcg cccgatttcgcggcgcccgatcaggcgcagatcagcacggtcggcgacgtcatcgccttc gtcgaggcgcagatcgcggcgcgaggcggccggggaggggcgccttga

DBGET integrated database retrieval system