Sorangium cellulosum So ce56: sce2528 Help Entry sce2528           CDS       T00634                                  Symbol acpM Name (GenBank) Hypothetical protein   KO K02078   acyl carrier protein Organism scl  Sorangium cellulosum So ce56 Pathway scl00998   Biosynthesis of various antibiotics scl01100   Metabolic pathways scl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     sce2528 (acpM)    00074 Mycolic acid biosynthesis     sce2528 (acpM)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     sce2528 (acpM) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 DUF7080 Motif Other DBs NCBI-ProteinID:  CAN92687 UniProt:  A9G6F8 LinkDB All DBs Position complement(3410001..3410252) Genome browser AA seq 83 aa AA seqDB search MTDKTNLLEIFKTVAARVDKREFPNVTATSVITELGIDSLSMMQIVGEMETELGIMIPDE DLVELITVGDLCKKVGERLEATV NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgacggacaagaccaatctgctcgagattttcaagacggttgccgcccgggtggacaag cgcgagttccccaatgtcaccgcgacgtctgtgatcacggagctcggcatcgactcgctc tcgatgatgcagatcgtgggagagatggagaccgagctcgggatcatgatcccggacgag gatctggtcgagctcatcaccgtgggcgacctctgcaagaaggtcggagagcggctggag gcgaccgtatga

DBGET integrated database retrieval system