Sorangium cellulosum So ce56: sce3814 Help Entry sce3814           CDS       T00634                                  Symbol acpP3 Name (GenBank) Hypothetical protein   KO K02078   acyl carrier protein Organism scl  Sorangium cellulosum So ce56 Pathway scl00998   Biosynthesis of various antibiotics scl01100   Metabolic pathways scl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     sce3814 (acpP3)    00074 Mycolic acid biosynthesis     sce3814 (acpP3)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     sce3814 (acpP3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  CAN93974 UniProt:  A9GWT9 LinkDB All DBs Position complement(5311651..5311905) Genome browser AA seq 84 aa AA seqDB search MAEGRDITAEVKRIIKEQLDVDEKDIKPEASFIDDLGADSLGLVELVLAFEEAFEIDIPD EDTEKIRTVQDAIDYIERNAKDKK NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggctgaaggtcgcgacatcacggccgaagtaaagcggatcatcaaggaacagctcgac gtcgacgagaaggacatcaagcctgaggcgagtttcatcgacgatctgggcgccgattcg ctgggcctggtggagcttgtcctcgcgttcgaggaggcgttcgagatcgacattccggac gaggacacggagaagatccggactgtccaggatgcgattgactacatcgaaaggaatgcc aaggacaagaagtag

DBGET integrated database retrieval system