Streptomyces clavuligerus: BB341_07440 Help Entry BB341_07440       CDS       T04717                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sclf  Streptomyces clavuligerus Pathway sclf00998   Biosynthesis of various antibiotics sclf01100   Metabolic pathways sclf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sclf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BB341_07440    00074 Mycolic acid biosynthesis     BB341_07440   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BB341_07440 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Ribosomal_L50 DUF6137 Motif Other DBs NCBI-ProteinID:  ANW18068 UniProt:  B5GL46 LinkDB All DBs Position 1938346..1938591 Genome browser AA seq 81 aa AA seqDB search MTEKEFIDVLAPLMEEIIGTTINETQLDITFGDLDVDSLNQIEIITRIEDAFDCEIDDST LRTIRTPRGVMEYIAGVSATR NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaccgagaaagagttcatcgacgttctggcacctctgatggaggaaatcatcgggacg acgatcaacgagacccagctcgacatcactttcggcgatctggatgtggactccctgaac cagatagagatcatcactcggatcgaggatgccttcgactgcgagatagacgacagcacc ctgcggaccattcgcactccacgcggcgtcatggaatacatcgccggcgtcagcgccact cggtga

DBGET integrated database retrieval system