KEGG   Streptomyces clavuligerus: BB341_07840
Entry
BB341_07840       CDS       T04717                                 
Name
(GenBank) oxidoreductase
  KO
K12677  clavulanate-9-aldehyde reducatase
Organism
sclf  Streptomyces clavuligerus
Pathway
sclf00331  Clavulanic acid biosynthesis
sclf01100  Metabolic pathways
sclf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sclf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00331 Clavulanic acid biosynthesis
    BB341_07840
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776 Epimerase THF_DHG_CYH_C Shikimate_DH PhrC_PhrF DUF3854
Other DBs
NCBI-ProteinID: ANW18142
UniProt: B5GLD3
LinkDB
Position
complement(2042059..2042805)
AA seq 248 aa
MMPSALQGKVALITGASSGIGEATARALAAEGAAVAIAARRVEKLRALGDELTAAGAKVH
VLELDVADRQGVDAAVASTVEALGGLDILVNNAGIMLLGPVEDADTTDWTRMIDTNLLGL
MYMTRAALPHLLRSKGTVVQMSSIAGRVNVRNAAVYQATKFGVNAFSETLRQEVTERGVR
VVVIEPGTTDTELRGHITHTATKEMYEQRISQIRKLQAQDIAEAVRYAVTAPHHATVHEI
FIRPTDQV
NT seq 747 nt   +upstreamnt  +downstreamnt
atgatgccatccgcactccaggggaaagtcgcgctcatcacgggcgcgagctcgggcatc
ggcgaggccacggcccgcgccctggccgccgagggcgccgccgtggccatcgccgcgcgc
cgggtcgagaagctgcgcgccctgggtgacgagctgaccgccgccggggcgaaggtccat
gtcctcgaactcgacgtcgccgaccggcagggggtggacgccgccgtcgcctccaccgtc
gaggcgctgggcggcctcgacatcctcgtcaacaacgccgggatcatgctgctcggcccg
gtggaggacgccgacaccaccgactggacccggatgatcgacaccaatctcctgggcctg
atgtacatgacccgggcggcccttccccatctgctgcgcagcaagggcaccgtggtgcag
atgtcctcgatcgcgggccgggtgaacgtccgcaacgcggccgtctaccaggccacgaag
ttcggtgtgaacgcgttcagcgagacgctgcgccaggaggtcaccgagcgcggggtgcgg
gtcgtcgtcatcgagccgggcaccaccgacacggagctgcgcggccacatcacccacacc
gccaccaaggagatgtacgagcagcggatcagccagatccgcaagctccaggcccaggac
atcgcggaggcggtccgctacgccgtgaccgcgccgcaccacgcgaccgtccacgagatc
ttcatacgccccaccgaccaggtctga

DBGET integrated database retrieval system