Streptomyces clavuligerus: BB341_08505 Help Entry BB341_08505       CDS       T04717                                  Name (GenBank) glutaredoxin-like protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism sclf  Streptomyces clavuligerus Brite KEGG Orthology (KO) [BR:sclf00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     BB341_08505 Enzymes [BR:sclf01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      BB341_08505 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 GST_N_2 GST_N_3 Glrx-like Thioredoxin IU_nuc_hydro Motif Other DBs NCBI-ProteinID:  ANW18260 UniProt:  B5GQ82 LinkDB All DBs Position 2192688..2192930 Genome browser AA seq 80 aa AA seqDB search MSGTVTMYSTTWCGYCRRLKSQMDREGIAYTEINIEQDPESAAFVEKANGGNQTVPTVLF PDGSTLTNPSLAQVKEKVGV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtcgggcactgtgacgatgtacagcaccacctggtgcggatactgccgtcggctgaag agccagatggaccgcgagggcatcgcgtacaccgagatcaacatcgagcaggacccggag tccgccgcgttcgtggagaaggccaacgggggcaaccagacggtgccgaccgtgctcttc ccggacggctcgacgctgacgaacccctcgctcgcgcaggtcaaggagaaggtcggcgtc tga

DBGET integrated database retrieval system