Streptomyces clavuligerus: BB341_20130 Help Entry BB341_20130       CDS       T04717                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sclf  Streptomyces clavuligerus Pathway sclf00998   Biosynthesis of various antibiotics sclf01100   Metabolic pathways sclf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sclf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BB341_20130    00074 Mycolic acid biosynthesis     BB341_20130   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BB341_20130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ANW20352 UniProt:  B5GQL8 LinkDB All DBs Position complement(4961295..4961543) Genome browser AA seq 82 aa AA seqDB search MAATQEEIVAGLAEIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DDDVKNLKTVGDAADYIAKHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccacgcaggaagagatcgttgccggtctcgcggagatcgtgaacgagatcgcc ggtatcccggtcgaggacgtccagctggacaagtccttcaccgatgacctggacgtggac tcgctgtccatggtcgaggtcgtcgtcgccgccgaggagcgcttcgacgtgaagatcccg gacgacgacgtcaagaacctgaagacggtcggcgacgccgcggactacatcgcgaagcac caggcctga

DBGET integrated database retrieval system