KEGG   Sphingobium cloacae: SCLO_1027400
Entry
SCLO_1027400      CDS       T05301                                 
Name
(GenBank) YjgP/YjgQ family permease
  KO
K07091  lipopolysaccharide export system permease protein
Organism
sclo  Sphingobium cloacae
Pathway
sclo02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sclo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SCLO_1027400
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sclo02000]
    SCLO_1027400
Transporters [BR:sclo02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    SCLO_1027400
SSDB
Motif
Pfam: LptF_LptG
Other DBs
NCBI-ProteinID: BAV65780
UniProt: A0A1E1F5I0
LinkDB
Position
SCLO_1:complement(3165697..3166932)
AA seq 411 aa
MKLTAIDRYLARLIALPMLGTLVVAAMLLVLDKMLSLFDFVAAEGGPVSVVWRMLANMLP
EYLSLGIPIGLMLGILLAFRKLAQTSELDVMRAVGLSYGRLLRVPYLFAMGMAVLNLGIV
GFVQPLSRHAYEALRFELRSGALGASIKVGEFTSLGKRMTMRIERSLDEGRNLQGIFVRA
EGKNGQSLAVTAAQGSFLATDDPDTIIFRLRDGVLVNNAPQYKTPRILSFSSHDLPIDLP
QIESFRGRDVDREKTIIELVQIAHDPATPQKLRNEVRANFHFRVVEVVMMMLLPLAALAF
AIPPKRSTSALGVFLSIVFIVTYHKINQYGESVGALGRVDPIIALWGPFLLTAALIFWMY
HVIAHRPGGQPIGALEFAFAKIGKKLRSILPTGTRRNGGSTSQDAEAEGAA
NT seq 1236 nt   +upstreamnt  +downstreamnt
ttgaaactgaccgccatcgaccgataccttgcccgcctgatcgccctgcccatgctgggc
acgctggtcgtggccgccatgctgctggtgctggacaagatgctgagcctgttcgacttc
gtcgcggcggaaggcgggccggtcagcgtcgtgtggcggatgctggccaacatgctgccg
gaatatctttcgctcggcattccgatcgggttgatgctggggatattgctggctttccgc
aagctggcgcagacatcggaactggacgtgatgcgggcggtgggcctgtcctacgggcgg
ctgctgcgggtgccctatctgttcgcgatgggcatggcggtgctgaacctgggcatcgtc
ggcttcgtccagccgctgtcgcgccatgcctatgaggcgctgcggttcgagttgcgctcg
ggcgctctgggcgcgtcgatcaaggtcggcgagttcacgagcctgggcaagcgcatgacc
atgcggatcgagcgcagcctggacgaagggcgcaacctccagggcatattcgtgcgggcc
gaagggaagaacgggcaatcgctggcggtgacggcggcgcagggcagcttcctggcgacg
gacgatccggacaccatcatcttccgcctgcgcgacggcgtgctggtcaacaatgcgccc
caatataagacgccgcgaatcctctccttctccagccacgacctgcccatcgacctgccc
cagatagagagtttccgcgggcgcgacgtggaccgggaaaagacgatcatcgaactggtc
cagatcgcccatgaccccgccacgccgcaaaagctgcggaacgaggtacgcgccaatttc
catttccgcgtggtggaggtggtgatgatgatgctcctgccgctcgccgcgctggccttc
gcgattccgcccaagcgatcgacttcggcgctgggcgtgttcctctccatcgtgttcatc
gtgacctatcacaagatcaaccaatatggcgaaagcgtcggggcgctgggccgggtcgac
ccgatcatcgcattgtgggggccgttcctgttgacggcggccctgatcttctggatgtat
catgtgattgcgcaccggcccggcggccagcctatcggcgcgctggaatttgccttcgcc
aagatcggcaagaagctgcggagcatcctgccgacgggcacccggcgcaacggcgggtcc
acgtcacaagacgcagaagcggagggagcggcgtga

DBGET integrated database retrieval system