Sphingobium cloacae: SCLO_1030590
Help
Entry
SCLO_1030590 CDS
T05301
Name
(GenBank) homolog of microcin C7 resistance protein MccF
KO
K01297
muramoyltetrapeptide carboxypeptidase [EC:
3.4.17.13
]
Organism
sclo
Sphingobium cloacae
Brite
KEGG Orthology (KO) [BR:
sclo00001
]
09180 Brite Hierarchies
09181 Protein families: metabolism
01002 Peptidases and inhibitors [BR:
sclo01002
]
SCLO_1030590
01011 Peptidoglycan biosynthesis and degradation proteins [BR:
sclo01011
]
SCLO_1030590
Enzymes [BR:
sclo01000
]
3. Hydrolases
3.4 Acting on peptide bonds (peptidases)
3.4.17 Metallocarboxypeptidases
3.4.17.13 muramoyltetrapeptide carboxypeptidase
SCLO_1030590
Peptidases and inhibitors [BR:
sclo01002
]
Serine peptidases
Family S66
SCLO_1030590
Peptidoglycan biosynthesis and degradation proteins [BR:
sclo01011
]
Precursor biosynthesis
Carboxypeptidase
SCLO_1030590
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Peptidase_S66C
Peptidase_S66
DAO_C
Motif
Other DBs
NCBI-ProteinID:
BAV66099
UniProt:
A0A1E1F6F6
LinkDB
All DBs
Position
SCLO_1:3511187..3512236
Genome browser
AA seq
349 aa
AA seq
DB search
MTIAFDRRALIAAMGGALIAAKAPAVPGTDPAPAFVKPPRLRPGDTVGLIEPAGFTDDAF
DLDLVKETIAAMGLKPKFARHLVERYGYLAGKDADRAADVNALYADPEVRAIFAVRGGWG
CARILPFLDFRTIRANPKLLIGFSDITALHLAFAARAGFTTIHGPNASASWPGFSWDAFR
AIAFDGATPTLVNPAGREDRLVQRIGRIRTFRSGTASGRLLGGNLTVLAALMGTPWLPDF
TGAILFLEDTNEAPYRVDRMLTQLALGGVLGKLAGVVFGQCTGCAPEGPSYGGFTLSEVL
QQHLEPLGIPAFQGAQFGHVASQFSLPVGVRAQIDSDAGSIRLLEPAVA
NT seq
1050 nt
NT seq
+upstream
nt +downstream
nt
ttgaccatcgcattcgaccgccgcgcgctgatcgcggccatgggcggcgcgctgatcgcg
gccaaggcgcccgccgtgccggggaccgatcccgcgcctgccttcgtgaagccgccccgc
ctgcgtcccggcgacacggtggggctgatcgagccggcgggcttcaccgatgacgccttc
gaccttgatctggtcaaggaaaccatcgccgccatgggattgaagcccaagttcgcgcgg
catctggtggaacgctatggctatctggcggggaaggacgcggatcgcgcggcggacgtg
aacgcgctttacgccgatcccgaagtgcgcgccatcttcgccgtgcgcgggggctggggc
tgcgcgcgcatcctccccttcctcgatttcaggacgatccgcgccaacccgaagctgctg
atcggtttcagcgacatcaccgcgctgcaccttgccttcgcggcgcgggcaggattcacc
accatccacggccccaatgcctcggcaagctggccgggcttttcctgggacgccttccgc
gccatcgccttcgacggcgccacgcccacgctggtcaatccggcggggcgggaggatcgg
ctcgtccagcgcatcggccgcatccgcaccttccgttccggcacggcgagcgggcggttg
ctgggcggcaacctcaccgtgctcgccgcgctgatggggacgccctggctgcccgacttc
accggcgcgatcctctttctggaggacactaacgaagcgccctaccgcgtcgaccggatg
ctgacccaattggcgctgggcggcgtgctgggcaagctggccggcgtggtgttcggccaa
tgcaccggctgcgcgcccgaaggcccgtcctatggcggcttcaccctgtcggaagtattg
cagcagcatctggaaccgctgggcatcccggcctttcagggcgcgcagttcggccacgtc
gccagccagttcagcctccccgtcggcgtgcgcgcgcagatcgactcggacgcaggcagc
atccgcctgctggaaccggcggtggcttga
DBGET
integrated database retrieval system