Styela clava (leathery sea squirt): 120326854 Help Entry 120326854         CDS       T07291                                  Name (RefSeq) protein chibby homolog 1-like   KO K23402   protein chibby 1 Organism sclv  Styela clava (leathery sea squirt) Pathway sclv04310   Wnt signaling pathway Brite KEGG Orthology (KO) [BR:sclv00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     120326854  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:sclv03037]     120326854 Cilium and associated proteins [BR:sclv03037]  Primary cilia and associated proteins   Other primary cilia associated proteins    120326854 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Chibby Motif Other DBs NCBI-GeneID:  120326854 NCBI-ProteinID:  XP_039249143 LinkDB All DBs Position Unknown AA seq 124 aa AA seqDB search MGLFGNKGFSPKKASPRKAASLSNLAALDATQRAQEFGLDYGSASLKLNGTQLKFEDGTW HADTGSSLPQREVVKLRKDNQKLLEENNMLKLKIDILLDMLSESAAECHILEKERDEALK TGKF NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgggtctatttggaaacaagggtttcagccccaaaaaagcctcaccaagaaaagcagca tcattgtcaaacttagccgcactcgatgctacacaaagagctcaagaatttggattagat tatggttctgcatctctcaaactcaatggtacccaacttaaatttgaagatgggacgtgg cacgctgatacggggtcatcattgccacagagagaagttgtaaagttacgtaaagataat cagaaacttctggaagaaaataacatgttgaaactgaaaattgacattttgctggatatg ttatcagaaagtgcagcagaatgtcatatactagaaaaagagagagatgaggcgctgaaa actgggaaattctag

DBGET integrated database retrieval system