Schizophyllum commune: SCHCO_02631114 Help Entry SCHCO_02631114    CDS       T01331                                  Symbol SCHCODRAFT_02631114 Name (RefSeq) ubiquitin-like protein   KO K13113   ubiquitin-like protein 5 Organism scm  Schizophyllum commune Brite KEGG Orthology (KO) [BR:scm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:scm03041]     SCHCO_02631114 (SCHCODRAFT_02631114)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:scm04052]     SCHCO_02631114 (SCHCODRAFT_02631114) Spliceosome [BR:scm03041]  Complex B   Other components    Complex B specific factors     SCHCO_02631114 (SCHCODRAFT_02631114) Cytokines and neuropeptides [BR:scm04052]  Neuropeptides   Unclassified    SCHCO_02631114 (SCHCODRAFT_02631114) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler OTU1_UBXL Rad60-SLD PI3K_rbd RAWUL Motif Other DBs NCBI-GeneID:  9591645 NCBI-ProteinID:  XP_003030225 UniProt:  D8QA10 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MALIEVIANDRLGRKVRVKCSPDDTVGDLKKLIAAQTGTDASKIQLKKWYTIYKDHITLA DYEIHDGMSLEMY NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggctctgattgaggtgattgcgaacgaccgtctaggacgcaaggttcgcgtgaaatgc agcccagatgacaccgttggcgatctgaagaagctcatcgccgcgcagaccggcacggat gcttcgaagatccagctaaagaaatggtacaccatatacaaggatcacatcacgcttgcg gactacgagatccacgacgggatgagccttgaaatgtactaa

DBGET integrated database retrieval system