KEGG   Streptomyces coelicolor: SCO5023
Entry
SCO5023           CDS       T00085                                 
Symbol
SCK15.25
Name
(RefSeq) hypothetical protein
  KO
K14628  enoyl reductase
Organism
sco  Streptomyces coelicolor
Pathway
sco01057  Biosynthesis of type II polyketide products
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
Module
sco_M00779  Dihydrokalafungin biosynthesis, octaketide => dihydrokalafungin
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    SCO5023 (SCK15.25)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:sco01008]
    SCO5023 (SCK15.25)
Polyketide biosynthesis proteins [BR:sco01008]
 Polyketide tailoring proteins
  Others
   SCO5023 (SCK15.25)
SSDB
Motif
Pfam: Cytotoxic
Other DBs
NCBI-GeneID: 1100464
Kitasato: SCO5023
UniProt: Q9KY79
LinkDB
Position
5456892..5457902
AA seq 336 aa
MRCATVAAIVLVSVISAPMAFAGGRGEGGSRGSTDQQANADGNGTVSVTVGGVVFDRSKN
GSGDSVGAVTSSTSWSPPACWYAPKYTPEELQDYLEPIWEAESTGYEWDAKQREKYNAKD
EKKGFNKDKTGKGFWWGSYVNESFPPGWDKCDTDYFWVDTGDPPPADKENAVTPEVLAEL
AYAEIRVPGTEVTLAPAEATKVNLPTWAWLDGAEFKPVSVTASVKEIGIEATATAEPVSL
QIKPGTPDAETYPASGVCEIKNGRIGAPYEKGRADDAPPCGVKYLRSSGDGTFPLQATVT
WEIHWTGTGGAGGDLPDGTFGATQDVVVQEIQAVNR
NT seq 1011 nt   +upstreamnt  +downstreamnt
ttgaggtgtgcgaccgtagccgcgatcgttctcgtctcggtgatatcggccccgatggcc
ttcgcgggcgggcgaggcgagggcggcagtcgcggctccacggatcaacaagccaacgcc
gacggtaatggcaccgtttcagtcacggtaggcggtgtcgtcttcgaccgttcgaagaac
gggagcggcgattcggtcggtgcggtgacgtcgtccacctcctggagcccgccggcgtgc
tggtacgccccgaagtacacgcccgaggagttgcaggattacctggaacccatctgggag
gccgagtccacggggtacgagtgggatgccaagcagcgggagaagtacaacgcgaaggat
gagaagaagggcttcaacaaggacaagacgggcaagggcttctggtggggctcgtacgtg
aacgagagcttcccgcccggctgggacaagtgcgacacggactatttctgggtggacacg
ggtgacccgccgcccgcggacaaggagaacgcggtcaccccggaggtcctcgccgaactc
gcctacgcggagatccgcgtccccgggaccgaggtgacgctggcgcccgccgaggcgacc
aaggtgaaccttccgacgtgggcgtggctggacggtgccgagttcaagccggtctcggtc
accgcgtccgtgaaggagatcggcatcgaggcgacggccacggccgagccggtctcgctg
cagatcaagccgggcaccccggacgccgagacctacccggcgtcgggagtctgcgagatc
aagaacggccgtatcggcgctccctacgagaagggcagggcggacgacgcacctccgtgc
ggcgtgaagtacctgcgttcctcgggcgacggcacgtttccgctccaggcgacggtcacg
tgggagatccactggaccggaaccggcggcgcgggcggcgaccttcccgacggtacgttc
ggcgccacccaggacgtcgtcgtccaggagatccaggccgtcaaccggtga

DBGET integrated database retrieval system