KEGG   Streptomyces coelicolor: SCO5882
Entry
SCO5882           CDS       T00085                                 
Symbol
redV, SC3F7.02c
Name
(RefSeq) RedV protein
  KO
K21785  4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
Organism
sco  Streptomyces coelicolor
Pathway
sco00333  Prodigiosin biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
Module
sco_M00838  Undecylprodigiosin biosynthesis, L-proline => undecylprodigiosin
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SCO5882 (redV)
SSDB
Motif
Pfam: Nitroreductase
Other DBs
NCBI-GeneID: 1101324
Kitasato: SCO5882
UniProt: O54145
LinkDB
Position
complement(6439123..6440310)
AA seq 395 aa
MTTRRTDHMAAAVSTFAQALETAAGTAALSPSSHNCQPWGLGRATSTTARRSAADLTGAD
ADEYLVLALDRERELTALAAHAVEMEVSCGVYWRILLRTLAAQGWTTAAVRVLDGDADPG
AAGLPGGGRPFGAGWPTAWTPLCVVALRPGPLSGERPADLHESALARRTHRGPYGREPVA
PGLLRDLEEPATPGATAHPVHLRHLTERRDLRAFAAFVARHAGRDFGHRAAWRETHSFVR
RDTADATARGDGFTLEQLFGPMSRPRRAAMRLALAPTTMHLLGKVGYHRVLAAGLADVVR
RTPAVVTMGFAGQAPTRAEQLEGGARLADYWWRATRHGLSLHPISIVLQHDDLRGRLERE
LSLPGRTFFVSRVGVAGSPAPRSHRRADAAVHVSF
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgacgacccgcaggacagaccacatggccgcggccgtgtccacgttcgcccaggcgctg
gagacggcggccgggacggcggcgctgagtccctcctcccacaactgccagccgtggggc
ctgggccgtgccacgagcaccacggcccgccggtcggcggcggacctgaccggcgcggac
gcggacgagtacctggtcctggccctcgaccgcgagcgggagctgacggcgctggccgcg
cacgcggtggagatggaggtcagctgcggcgtctactggcggatcctgctccgcacgctg
gcggcccagggctggacgacggcggcggtgcgcgtcctggacggcgacgcggaccccggc
gcggcggggctgcccggcggcggccgcccgttcggtgccggatggccgacggcgtggacg
ccgctgtgcgtggtggcgctgcgccccgggccgctctccggagaacggccggccgacctg
cacgagagcgccctcgcccgccgcacccaccgcggcccctacgggcgggagccggtggcc
cccgggctgctgcgcgacctggaggagcccgccacacccggagccacggcacacccggtc
cacctccggcacctgaccgagcggcgcgacctgcgggcgttcgcggcgttcgtcgcccgg
cacgcgggacgcgacttcgggcaccgggccgcctggcgggagacccactccttcgtccgc
cgggacaccgcggacgcgaccgcgcggggcgacgggttcacgctggagcagctcttcggg
cccatgtcccggccgcgccgggcggcgatgcgcctcgcgctggccccgacgacgatgcac
ctgctgggcaaggtcggctaccaccgggtgctggccgccggtctcgccgacgtcgtgcgc
cgcactccggccgtggtgaccatgggcttcgccgggcaggcgcccacacgggcggagcag
ctcgagggcggggcgcgactggccgactactggtggcgggcgacccgccacggcctgtcc
ctgcaccccatcagcatcgtcctccagcacgacgacctgcgcggccggctggagcgggaa
ctctccctgcccggccgcaccttcttcgtgagccgggtcggtgtggccggctcgcccgcg
ccgcgctcccaccggcgcgcggacgccgccgtgcacgtgtccttctga

DBGET integrated database retrieval system