Streptomyces coelicolor: SCO5887 Help Entry SCO5887           CDS       T00085                                  Symbol SC3F7.07c Name (GenBank) acyl carrier protein   KO K21790   acyl carrier protein Organism sco  Streptomyces coelicolor Pathway sco00333   Prodigiosin biosynthesis sco01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sco00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00333 Prodigiosin biosynthesis     SCO5887 (SC3F7.07c) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  CAA16178 Kitasato:  SCO5887 UniProt:  O54150 LinkDB All DBs Position complement(6443973..6444218) Genome browser AA seq 81 aa AA seqDB search MSTTYDKLVDLLVDGFAVDRAAIRPDVTFEELEMDSLFLVELLLVIQSEFGVKISDDAAV PTDTIAHAVALVDNEIAATAS NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagcaccacctacgacaagctcgttgatctgctggtcgacggtttcgcggtggaccgc gctgcgatccgtccggacgtgaccttcgaagagctggagatggactcgctgttcctcgtg gaactgctgctcgtcatccagtccgagttcggcgtgaagatcagcgacgacgccgcggtc cccacggacaccatcgcccacgcggtggccctggtcgacaacgagatcgcggccaccgcg tcatga

DBGET integrated database retrieval system