KEGG   Streptomyces coelicolor: SCO5894
Entry
SCO5894           CDS       T00085                                 
Symbol
redJ, SC3F7.14
Name
(RefSeq) thioesterase
  KO
K21791  thioesterase
Organism
sco  Streptomyces coelicolor
Pathway
sco00333  Prodigiosin biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
Module
sco_M00838  Undecylprodigiosin biosynthesis, L-proline => undecylprodigiosin
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SCO5894 (redJ)
SSDB
Motif
Pfam: Thioesterase Abhydrolase_6 Hydrolase_4 Abhydrolase_3 Lipase_3
Other DBs
NCBI-GeneID: 1101336
Kitasato: SCO5894
UniProt: O54157
Structure
LinkDB
Position
6457476..6458318
AA seq 280 aa
MSPADLLSQRSAWFPRPVAAPAAEPPDPAAAPLRLVCFPYAGGTVSAFRGWQERLGDEVA
VVPVQLPGRGLRLRERPYDTMEPLAEAVADALEEHRLTHDYALFGHSMGALLAYEVACVL
RRRGAPRPRHLFVSGSRAPHLYGDRADHTLSDTALREVIRDLGGLDDADTLGAAYFDRRL
PVLRADLRACERYDWHPRPPLDCPTTAFSAAADPIATPEMVEAWRPYTTGSFLRRHLPGN
HFFLNGGPSRDRLLAHLGTELDALGTTPHRKATREATWTF
NT seq 843 nt   +upstreamnt  +downstreamnt
atgtcgcccgctgacctgctctcccagcgttccgcctggttcccccgccccgtcgcggca
ccggccgccgagccgcccgacccggcggccgccccgctgcgcctggtctgcttcccctac
gccggggggacggtctccgcgttccgcggctggcaggagcggctgggcgacgaggtcgcc
gtcgtacccgtacaactgcccggccgcggactgcgcctgcgcgagcggccgtacgacacc
atggaacccctcgccgaagcggtcgcggacgcgctggaggagcaccggctcacccacgac
tacgccctgttcgggcacagcatgggcgccctgctcgcctacgaggtggcctgcgtgctg
cgccggcgcggggcaccgcggccccggcacctgttcgtctccggcagccgggccccgcac
ctgtacggcgaccgcgccgaccacaccctgtccgacaccgccctgcgcgaggtcatccgg
gacctgggcggcctcgacgacgcggacaccctgggcgccgcctacttcgaccgcagactc
ccggtgctccgcgccgacctgcgcgcctgcgagcgctacgactggcacccccggccaccg
ctggactgcccgacgaccgcgttctccgccgccgccgaccccatcgccaccccggagatg
gtcgaggcctggcggccctacaccaccggctcgttcctgcggcgccacctgccgggcaac
cacttcttcctgaacggcggcccgtcccgcgaccggctgctcgcccacctgggcaccgaa
ctcgacgccctcggcaccaccccgcacaggaaggcaactagggaagcaacatggacattc
tga

DBGET integrated database retrieval system